China (Mainland)
Assessedsupplier 
GLucagon CAS NO.16941-32-5
- FOB Price: USD: 1.00-2.00 /Metric Ton Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: T/T
- Available Specifications:
Pharmaceutical grade(1-10)Metric TonPharmaceutical grade(10-100)Metric Ton
- Product Details
Keywords
- GLucagon 16941-32-5
- 98% purity
- GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;
Quick Details
- ProName: GLucagon
- CasNo: 16941-32-5
- Molecular Formula: C153H225N43O49S
- Appearance: white powder
- Application: Peptide
- DeliveryTime: 5-7days after payment
- PackAge: A variety of packing way
- Port: Shanghai/Guangzhou
- ProductionCapacity: 100 Gram/Day
- Purity: 98%
- Storage: -20°C
- Transportation: buy air
- LimitNum: 1 Gram
Superiority
Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards.
We are a leading peptide manufacturer in china and our products have competitive price.
Meanwhile, we provide the best service to our customers.
· ProName: Glucagon
· CasNo: 16941-32-5
· Appearance: white powder
· Application: Glucagon and Glucagon-like peptide
· DeliveryTime: 5-7days after payment
· PackAge: A variety of packing way
· Purity: 98-99%
· Storage: -20.0℃
· Transportation: by air or by sea
· LimitNum: 1 Gram
Details
· ProName: Glucagon
· CasNo: 16941-32-5
· Appearance: white powder
· Application: Glucagon and Glucagon-like peptide
· DeliveryTime: 5-7days after payment
· PackAge: A variety of packing way
· Purity: 98-99%
· Storage: -20.0℃
· Transportation: by air or by sea
· LimitNum: 1 Gram